Аденома простаты злокачественная опухоль лечение. Аденома это рак или нет, может ли перерасти. 2018-12-13 04:41

90 visitors think this article is helpful. 90 votes in total.

Аденома простаты злокачественная опухоль лечение

Вовторых, доброкачественная аденома простаты может перерасти в злокачественную опухоль. О симптомах и принципах лечения аденомы простаты в телепередаче Жить здорово! с Еленой Малышевой Многие мужчины считают, что аденома простаты и простатит являются одним заболеванием, и самостоятельно диагностируют их у себя при наличии нескольких симптомов. Простатит возникает как следствие инфекции, а аденома возникает из-за разрастания тканей, образующих предстательную железу, вследствие чего образуется опухоль. Аденома является доброкачественным образованием, не оказывающим влияния на состояние и функционирование других органов, и не провоцирующим возникновение метастазов. Рак простаты отличается от аденомы тем, что сопровождается разрастанием злокачественной опухоли. Если у мужчины диагностирована аденома, то развитие рака маловероятно. Злокачественная опухоль чаще всего поражает железистые ткани простаты мужчин, возраст которых 50-60 лет, и лишь в единичных случаях диагностируется у более молодых. Рак предстательной железы среди общего количества злокачественных опухолей наблюдается в 4% случаев. Точных причин, провоцирующих рак предстательной железы, ученые пока не могут назвать. Известно только то, что при наличии некоторых факторов увеличивается вероятность возникновения этого заболевания. К таким причинам относится неустойчивый гормональный фон, регулярное влияние канцерогенов на организм, недостаточное употребление продуктов, содержащих клетчатку, гиперплазия предстательной железы, генетический фактор. Доброкачественная и злокачественная опухоли в самом начале развития имеют похожие симптомы, поэтому их сложно отличить без дополнительного обследования. Тревожными признаками в обоих случаях могут служить учащенное, но затрудненное мочеиспускание, ощущение неполного опустошение мочевого пузыря. В случае аденомы симптомы могут не усиливаться, а рак сопровождается потерей веса, возникновением характерных болей вследствие разрастания злокачественной опухоли. Клетки злокачественной опухоли разрастаются медленно, поэтому часто случается так, что мужчина не обращается к специалистам на начальной стадии. В отличие от доброкачественной аденомы, разрастающейся в центральной части органа, раковые клетки в 90% случаев появляются в периферических отделах органа. Одновременно аденома и рак наблюдаются только в 25% случаев. Чаще всего первая стадия рака простаты выявляется случайно, если мужчина подвергается обследованию, связанному с другими заболеваниями. На второй стадии больной не ощущает никаких изменений со стороны здоровья: мочеиспускание не нарушено, болевые ощущения не наблюдаются. Вторая стадия рака может быть выявлена при проведении биопсии. Возможно обнаружение плотного узла в предстательной железе во время ректального исследования. Третья стадия характеризуется гематурией, дискомфортом, учащенным мочеиспусканием. В некоторых случаях образуются метастазы в области тазовых лимфоузлов. Злокачественная опухоль постепенно увеличивается, нарушая основание мочевого пузыря, стенки таза, полость семенных пузырьков. Четвертая стадия сопровождается дизурическми расстройствами. Большая вероятность образования метастазных проявлений, поражающих кости и внутренние органы. При обследовании обнаруживается опухоль больших размеров. В сыворотке крови увеличивается уровень кислой фосфатазы. Метастазы поражают подвздошные узлы, кости, расположенные вблизи простаты, близлежащие органы — легкие, печень. Злокачественная опухоль очень долго может не выражаться никакими симптомами, поэтому обнаруживается при обследованиях, связанных с другими заболеваниями. Только на последних стадиях ухудшается самочувствие, уменьшается вес. Значительное ухудшение самочувствия связано с появлением метастазов. Чтобы выявить рак предстательной железы как можно раньше, мужчины сами должны следить за регулярностью профилактических обследований у уролога. Если по прошествии некоторого времени появился дискомфорт в области таза, то следует повторить посещение специалиста. Малейшее подозрение на рак предстательной железы – повод провести биопсию. Этот метод позволяет диагностировать опасное заболевание на начальных стадиях, от чего зависит успех лечения. Среди способов диагностики могут использоваться компьютерная томография, рентгенография, экскреторная урография. Особенное внимание во время обследования следует уделить полости забрюшинного пространства, чтобы обнаружить метастазные проявления, если они уже появились. Если обнаружена аденома, то выздоровление практически гарантировано. Злокачественная опухоль на последних стадиях вылечивается гораздо сложнее. На первой стадии выполняют наблюдение за опухолью в динамике. В случае увеличения прорастания злокачественных клеток эффективны простатэктомия, сопровождающаяся лучевой терапией. Этот метод считается наиболее действенным в лечении рака простаты, и позволяет избавиться от опухоли даже тех случаях, когда раковые клетки развивались на протяжении 10 лет. Количество выздоровевших после радикальной простатэктомии насчитывает примерно 80-90%. Для избавления от опухоли могут использоваться радиотерапия и медикаментозная химиотерапия. Терапия может быть изменена в процессе лечения, состояние опухоли наблюдается в динамике. Рак простаты, выявленный на первой и второй стадиях, вылечивается практически в 100% случаев. Обнаруженный рак на четвертой стадии оставляет меньше шансов на жизнь. Главная задача – выявить опухоль на раннем этапе, поэтому всем мужчинам следует регулярно посещать андролога для обследования. Это позволит избежать смертельного исхода при обнаружении рака предстательной железы. В израильском онкоцентре Ихилов лечение рака простаты проводится с применением современных инновационных методов. К ним относится удаление простаты (радикальная простатэктомия) с помощью последней модели робота-хирурга «Да Винчи» — Da Vinci Xi. Такие операции отличаются меньшим риском послеоперационных осложнений, сокращением сроков восстановления. Выполняются также лапароскопические операции по удалению простаты, которые проводятся через 3-4 небольших прокола. Наряду с хирургией, для лечения рака простаты в онкоцентре широко применяется радиотерапия, в том числе брахитерапия. В ходе этой процедуры в ткань простаты внедряются крошечные капсулы – «зерна», содержащие радиоактивный материал. В некоторых случаях брахитерапия может быть альтернативой хирургическому вмешательству. Больному также может быть назначена дистанционная радиотерапия с применением технологии Rapid Arc. Обычно такое лечение проводится в комплексе с гормонотерапией. Если вы хотите подробнее узнать о лечении рака простаты в Израиле, в онкоцентре Ихилов, обратитесь на наш сайт. Там вы сможете получить консультацию опытного врача.

Next

Аденома простаты. Урология, нефрология

Аденома простаты злокачественная опухоль лечение

Аденома простаты. Эти методы могут также дополнять консервативное лечение. Сегодня рак предстательной железы является наиболее распространенным видом рака у представителей сильного пола. Летальные исходы в результате злокачественной опухоли аденомы простаты находятся на 2-м месте, уступая первенство лишь раку легких. мужчин слышат в свой адрес такой диагноз доктора – «рак предстательной железы». Если рассматривать статистику такого заболевания, как раковая опухоль предстательной железы, то становится очевидно, что оно является одним из часто диагностируемым. Простата играет важнейшую роль в жизни каждого мужчины. Рак простаты — это злокачественная опухоль у мужчин. В медицинских источниках говорится о существенных отличиях данного заболевания от аденомы простаты. Каждый мужчина может самостоятельно следить за функционированием своего организма. Определяя симптомы начальной стадии развития рака простаты, можно увеличить шансы на выздоровление. Ощутить наиболее беспокоящие симптомы заболевший может лишь на последних стадиях. Поэтому для профилактики заболевания рекомендуется посещать профессионального врача. Злокачественная раковая опухоль постепенно проникает в близлежащие ткани и медленно увеличивается в размерах, в связи с чем возникают следующие симптомы: Мужчины, которые относятся к старшей возрастной категории, часто жалуются на перечисленные симптомы аденомы рак простаты. Но это совсем не свидетельствует о наличии такого страшного диагноза, как карцинома простаты. Возможно, простата просто воспалена или образовалась аденома. Не стоит все же опускать руки и безнадежно продолжать существование. Если все же был диагностирован рак простаты, то необходимо сразу начать лечение. Отсутствие метастаз на момент обнаружения опухоли — первый шаг к положительному прогнозу. Наука достигла хороших результатов в уничтожении раковых клеток предстательной железы. Действительно ли заболевший мужчина страдает от рака простаты, может сказать лишь узкий специалист. Биопсия – обязательная процедура в диагностировании рака. Она помогает с точностью определить, из каких клеток состоит обнаруженное новообразование: доброкачественных или злокачественных. В случае, когда специалист установил, что раковые клетки присутствуют в организме больного, он должен в своем отчете указать степень злокачественности заболевания. Этот показатель зависит от трех составляющих: Патолог использует в своей работе две клетки – раковую и здоровую. Чем больше больная клетка имеет отличий, тем агрессивнее протекает заболевание. отвечает на вопрос о последующей скорости роста злокачественной опухоли. Патологи утверждают: если диагностирован рак и по шкале определена степень ниже шести, то шансы на выздоровление значительно возрастают. Степень выше шести дает основание говорить о запущенности рака предстательной железы и о быстром его развитии. В связи с тем, что злокачественное образование развивается медленно, его редко можно обнаружить самостоятельно. На первых порах простата никак не беспокоит мужчину. Лишь через пару лет злокачественная опухоль даст о себе знать, так как именно столько времени ей понадобится на то, чтобы вырасти в два раза. В некоторых случаях раковые клетки не распространяются за пределы предстательной железы. Но если злосчастный недуг начал поражать другие органы, то прогноз обычно неутешителен: врачи дают не более трех лет. Существует несколько вариантов лечения рака предстательной железы. Для некоторых пациентов оптимальной является комбинация нескольких методов лечения, например, хирургическая операция, а затем лучевое лечение. Какое именно лечение вы с вашим врачом выберете, зависит от нескольких факторов: от того, насколько быстро растет раковая опухоль, как сильно она уже распространилась, от вашего возраста и общего состояния здоровья и от преимуществ и возможных побочных эффектов того или иного метода лечения. Лечение не начинается, пока опухоль небольших размеров, локализована и не растёт дальше. К сожалению, лечение химиотерапией при раке простаты может повлечь за собой неприятные побочные эффекты, так как препараты, борющиеся с раком, токсичны и пагубно действуют не только на раковые клетки, но и на здоровые. Среди побочных эффектов может быть выпадение волос, тошнота, рвота, утомляемость, нарушение работы кишечника и снижение иммунитета к инфекционным заболеваниям. Степень проявления побочных эффектов у разных людей разная. У некоторых они могут быть умеренными, в то время как у других — более выраженными. Иногда с помощью химиотерапии удается облегчить симптомы тяжелого рака, как, например, вызываемые им боли. Однако на сегодня нет данных, подтверждающих, что химиотерапия может продлить жизнь мужчин с поздней стадией рака. При лечении рака предстательной железы химиотерапия не дает такого хорошего эффекта, как при лечении других видов рака. К тому же, некоторые побочные эффекты этого лечения могут вести только к неудобствам, а другие — к более серьезным проблемам, как, например, нарушение иммунитета, снижение способности организма бороться с инфекцией. Яички продуцируют около 95% всех андрогенов в виде тестостерона. В яичках он продуцируется клетками Лейдига в ответ на стимуляцию специальным гормоном — лютеинизирующим гормоном (ЛГ), который создается секреторной частью особого отела мозга — гипофиза. Гипофиз, в свою очередь, не сам «принимает решение» о выработке лютеинизирующего гормона, а «по команде» высшего центра гормональной регуляции человеческого организма — гипоталамуса. Эта «команда» передается в форме рилизинг-гормона лютеинизирующего гормона гипоталамуса (ЛГРГ). Один из гормональных методов лечения заключается в том, что устанавливается химическая блокада, не допускающая прохождения к яичкам сигналов о необходимости выработки тестостерона. Некоторые медикаменты, называемые агонистами ЛГРГ, могут нарушить этот путь прохождения сигналов. Эти препараты являются синтетическими гормонами, похожими на естественный гормон ЛГРГ. Но они отключают механизм активации ЛГ, вместо того чтобы запускать его, и яички не получают сигнала к выработке тестостерона. Наиболее известные агонисты ЛГРГ — гозерелин, трипторелин, лейпрорелин. Однако специалисты призывают перед тем, как начать использование какого-либо рецепта, посоветоваться с лечащим врачом. Не все растения так полезны и безобидны, как это может показаться. Если же человек параллельно принимает какое-либо медикаментозное лечение, результаты могут быть непредсказуемы. Существуют несколько природных способов удерживать заболевание под контролем, а при использовании метода иммунотерапии рака простаты можно добиться полного излечения. Так, сотрудники Гарвардского университета открыли, что потребление ликопина (содержится в томатах) на 45% снизило опасность рака простаты у 48 000 человек, потреблявших как минимум десять порций томатов в неделю. Гранат снижает влияние токсинов цисплатина (химиотерапевтическое средство, применяемое онкологами) на почки и печень. Подтверждено, что стакан гранатового сока в день способен затормозить 67% рака простаты с метастазами в прогрессивной стадии. Лабораторные опыты показали, что гранат эффективнее, чем паклитаксел (цитостатик), коммерческое название которого Таксол, который применяется для лечения рака яичников поджелудочной железы. В гранате содержится много веществ, способных подавлять раковые клетки, это: флавоноиды, антоцианы, танины (эллаговая кислота, кверцетин, пуникалагин). Один из наиболее активных антиоксидантов фрукта — пуникалагин, считается самым мощным натуральным антиоксидантом. Целебный ингредиент, содержащийся в расторопше пятнистой, – силимарин, который вытягивают из семян этого растения. Силимарин обладает химиотерапевтическими свойствами и снижает побочные эффекты этой процедуры. Он заставляет цисплатин, паклитаксел и доксорубицин быть более эффективными при лечение рака простаты 3 и 4 степени. Также расторопша помогает регулировать уровень эстрогенов в крови и при гормонозависимых опухолях. В настоящее время известно о ее способности не только предупреждать, но и лечить рак тестикул и яичников. При заболевании рак простаты народное лечение заключается, в основном, в использовании растительных компонентов. Хорошее воздействие приписывают шишкам хмеля, из которых готовят либо настойку (шишки и спирт в соотношении 1:4), либо отвар. Отвар готовят из расчета 2 столовые ложки шишек на пол-литра кипятка. Настойку принимают по 40 капель трижды в день, а отвар по половине стакана. Народные средства рака простаты также используют чистотел. Это растение входит в состав многих целебных рецептов, но всегда есть предупреждение о дозировке, ведь превышение ее может привести к нежелательным последствиям. Чтобы приготовить чай из чистотела, 1 столовую ложку измельченной травы заливают тремя литрами кипятка и настаивают в течение 8 часов. Пьют отвар теплым по 1 стакану перед утренним и вечерним приемом пищи, за 40 минут. Основные цели – активация мононуклеаров, повышение числа и активности естественных киллеров, усиление выработки интерферонов, ряда необходимых цитокинов и неспецифических факторов противоопухолевой защиты. Все это, в конечном итоге, направлено на улучшение распознавания опухоли иммунной системой и ее уничтожение. Статистика по злокачественным опухолям и раку простаты в России. Согласно статистике по ракупростаты в России, каждый год количество заболевших возрастает на 8% — 9% (что составляет 34 тысячи новых случаев). Злокачественная опухоль не заразна и не может быть передана другому человеку. Что касается физической активности при раке простаты, то она является важным шагом к восстановлению здоровья. Но перед физическими нагрузками следует согласовать план тренировок с лечащим врачом. Упражнения при раке простаты, в первую очередь, должны быть направлены на укрепление мускулатуры малого таза. Многие мужчины испытывают страх или стыд перед посещением врача, ведь предстательная железа отвечает за выработку семенной жидкости. Но не стоит забывать, что качественная и своевременная диагностика спасает жизни. Каждый представитель сильного пола должен решить для себя, что забота о здоровье простаты — обязательная процедура. Здоровье человека во многом зависит от качества питания. Вредные продукты неблагоприятно воздействуют на многие жизненно важные системы организма. Онкологи уверяют, что лечение будет производить лучший эффект, если пациент уделит время для рассмотрения своего рациона. От этого будет зависеть сила иммунитета, а значит и способность бороться с внутренним врагом.

Next

Что такое аденома простаты у мужчин симптомы и признаки.

Аденома простаты злокачественная опухоль лечение

Существовало мнение, что аденома — предшественник ракового заболевания, и что доброкачественная опухоль имеет перспективу перерасти в злокачественную. На сегодняшний день выявлено, что это две разные. Аденома предстательной железы является проблемой многих мужчин, старше 40-50 лет. Это заболевание существенно ухудшает качество их жизни. В этой статье мы детально рассмотрели это лабораторное исследование. Предстательная железа — это секреторный орган, который находится у мужчин за мочевым пузырем. Аденома простаты – это доброкачественное разрастание тканей предстательной железы. Сама по себе, аденома простаты не опасна, и не приводит к смерти. Это заболевание еще называется доброкачественной гиперплазией. Опасными являются осложнения, которые могут развиться на ее фоне. Благодаря ему, врач может назначить лечение, и оттянуть развитие осложнений на максимально долгий период времени. Простатический специфический антиген (ПСА) – это белок, который в норме вырабатывается предстательной железой. Согласно медицинским протоколам, это исследование не входит в перечень обязательных скрининговых диагностических процедур, как например флюорография легких. К показаниям к этому исследованию относятся: В назначенный день, мужчине следует прийти с утра в лабораторию. Это связано с возрастным изменением уровня мужских половых гормонов. Затем, лаборант сообщает дату и время готовности результатов. Эти нормы относительны, они могут немного отличаться у каждого мужчины. Они зависят от гормонального фона, половой активности. Для его постановки, и выбора метода лечения, необходимо детальное обследование пациента. Детальное обследование необходимо для правильного постановления диагноза и назначения лечения. К ним относятся: Определение ПСА при аденоме простаты помогает выявить это заболевание на ранней стадии развития. Своевременно начатое лечение заболевания на ранней стадии дает возможность избежать хирургического вмешательства, и продлить половую активность на максимально долгое время.

Next

Рак простаты Симптомы РакаПростаты.нет

Аденома простаты злокачественная опухоль лечение

Особенность рака простаты в том, что злокачественная опухоль развивается медленно, а заметные симптомы рака простаты отсутствуют. Некоторые симптомы указывают на наличие возможного доброкачественного увеличения простаты, называемого аденомой простаты, а в худших случаях эти. Аденома простаты или его медицинское название доброкачественная гиперплазия предстательной железы – это наиболее распространенное урологическое заболевание у мужчин, особенно у тех, кто переступил пятидесятилетний рубеж. Аденома (с греческого языка означает «железа») – это доброкачественное образование, которое при этом сохраняет исходное строение железистой ткани. В настоящее время медицине не известны истинные причины возникновения данного заболевания предстательной железы. Специалисты рассматривают множество из них, которые могут спровоцировать развитие новообразований в железистых клетках ткани, но основной из них они выделяют изменение гормонального фона в мужском организме, которое происходит в силу возрастных изменений. Симптоматика заболевания может проявляться периодами, то усиливаясь, то ослабевая. Первые признаки заболевания проявляются в тот момент, когда опухоль мешает нормальному высвобождению мочи, в связи, с чем вызывается ряд типичных моментов заболевания: Аденома простаты у мужчин, сама по себе представляет собой узловую гиперплазию клеток предстательной железы. И первые признаки сопровождаются формированием мелких узелков, состоящих из клеток, которые очень быстро размножаются. Довольно долгий период происходит количественное увеличение этих узелков и только в определенный момент они начинают постепенно расти в размерах. Доброкачественная гиперплазия предстательной железы классифицируется по степеням, которые выявляются при получении значений суммарного балла МПИ (Международного простатического индекса) симптомов. Для этого больному предоставляют пройти тестирование, состоящее из списка вопросов, после которого выводится результат: Аденома простаты 1 степени: на этой стадии учащается мочеиспускание и днем и ночью, происходит задержка начала процесса мочеиспускания. Мышечная поверхность мочевого пузыря увеличивается в толщине, пациент начинает самопроизвольно тужиться, чтобы помочь процессу, вследствие чего мочевой пузырь начинает с трудом справляться с этой затруднительной задачей. Аденома простаты 2 степени: при данной степени заболевания уже наблюдается появление остаточной мочи, по причине которой мочевой пузырь уже не способен адекватно выполнять свои функции, в связи, с чем пациента постоянно мучает чувство желания помочиться. Аденома простаты 3 степени: данная стадия означает полной нарушение функции мочеиспускания, расширяется не только мочевой пузырь, но и другие органы – мочеточники, почки, появляется почечная недостаточность, пропадают позывы к мочеиспусканию и мочевой пузырь начинает по каплям выделять мочу. При второй и третьей степени развиваются такие осложнения, как инфекция мочевых путей, появление камней, выпячивание стенок мочевого пузыря, выделение мочи с кровью (гематурия) и другие. Стоит отметить, что при любой степени также возможно появление острой задержки мочи, которая требует срочной врачебной помощи. Отметим наличие такой разновидности рассматриваемого заболевания, как аденома простаты злокачественная. В данном случае имеется в виду опухоль, развившаяся в предстательной железе, но, к сожалению, являющейся злокачественным новообразованием. Данное заболевание называемое раком простаты, является каждой десятой причиной смерти от рака у мужчин. Первые признаки аденомы простаты, как уже было отмечено выше, дают о себе знать преимущественно со стороны нарушений функции мочеиспускания. Струя мочи ослабевает, пациент вынужден вставать из-за такого дискомфорта ночью, а еще хуже, когда мужчина вынужден бегать для опустошения мочевого пузыря чуть ли не каждые полчаса. Вот именно тогда уже необходимо обращаться за медицинской помощью, чего, к сожалению, многие пациенты не делают, а списывают на различные явления и отсрочивают визит к врачу. При обращении к специалисту назначается диагностика аденомы простаты: Далее назначается план лечения, который включает в основном медикаментозный метод – назначение андрогенов, антибиотиков, противовоспалительных и мочегонных средств, и лекарств, нормализующие венозный кровоток. Также полезны различные витамины, для укрепления общего организма. Следует избегать применения различных рекламных средств «таблетки от аденомы простаты« без консультации лечащего врача. Но одним из радикальных методов, все же, является хирургический. Современная медицина выделяет несколько направлений оперативного метода, среди которых наиболее оптимальный – это трансуретральная резекция простаты. Продолжительность процедуры менее 1,5 часа, эффективность более 90%. Боли при аденоме простаты могут появляться неожиданно и протекать очень интенсивно, если вовремя не обратиться за специализированной помощью. Простатит и аденома простаты, как правило, развиваются по причине длительных неблагоприятных застойных явлений в органах малого таза, а также как следствие перенесенного инфекционного простатита. Эти два недуга связаны между собой механизмом формирования, имеются лишь несколько специфических особенностей у аденомы. Лечение даст наиболее высокий шанс для излечения от аденомы простаты, если вовремя избежать застоя и отечности в органах.

Next

Аденома простаты злокачественная опухоль лечение

Рак предстательной железы это опухолевое образование злокачественного типа, характеризующееся отсутствием четко определяющей его симптоматики, соответственно, симптомы имеют общий характер. Симптомы рака предстательной железы прерывистость струи мочи, недержание мочи. Заболевание характеризуется образованием небольшого узелка или нескольких узелков, которые постепенно увеличиваются. Аденома простаты, в отличие от рака предстательной железы, протекает доброкачественно. Это одно из самых распространенных урологических заболеваний мужчин после 50 лет. Причины развития аденомы предстательной железы до конца не ясны. Основным фактором риска возникновения аденомы простаты является возраст - чем старше мужчина, тем выше риск развития аденомы. У молодых мужчин аденома предстательной желе­зы бывает очень редко. Это связано с возрастными изменениями в эндокринном регулировании половой системы мужчины, обусловленными гиперплазией парауретральных желез (у кастрированных или оскопленных мужчин случаев аденомы предстательной железы не зафиксировано). Заболевае­мость достигает 50% у мужчин после 50 лет, увеличивается в бо­лее поздних возрастных группах и является наиболее частой при­чиной нарушения функции мочевого пузыря. Старше 70 лет 75% мужчин в различной степени страдают от аденомы предстательной железы. Считается, что со временем она развивается у 85% мужчин. Клинические признаки и симптомы аденомы простаты крайне разнообразны и зависят от прогрессирования заболевания, соматического и психического статуса, возраста, социального положения и медицинской осведомленности пациента. Еще совсем недавно большинство врачей считали, что симптомы аденомы довольно типичны и соответствуют 3 стадиям (компенсированной, субклинической, декомпенсированной). К первым проявлениям аденомы простаты относят вялую струю мочи и запаздывание начальной фазы мочеиспускания, учащение позывов и появление императивных позывов (не заканчивающихся мочеиспусканием), особенно по ночам. С течением времени эти симптомы нарастают и появляются жалобы на затрудненное мочеиспускание, необходимость натуживаться и подключать мышцы брюшного пресса для опорожнения мочевого пузыря. Из-за снижения тонуса детрузора в полости мочевого пузыря появляется остаточная моча. Если больной не получает лечения, затрудненное мочеиспускание становится постоянным и преобладающим симптомом. Объем мочи при мочеиспускании постепенно уменьшается с 200-250 до 30-50 мл, струя мочи становится прерывистой, иногда выделяется по каплям, появляется непроизвольное, неконтролируемое истечение мочи по уретре. Тонус детрузора снижается настолько, что объем остаточной мочи достигает литра и более. К сожалению, зачастую мужчины рассматривают эти симптомы как возрастные и не обращаются к врачу своевременно. Что же заставляет мужчину с аденомой предстательной железы обратиться за медицинской помощью? В первую очередь, это наличие серьезных проблем с мочеиспусканием и половой функцией, характерных для данного заболевания. Симптомы аденомы делят на обструктивные и ирритативные. Ирритативные симптомы проявляются в виде учащенного мочеиспускания, пустых позывов и неудержания мочи (другими словами - симптомы раздражения) и определяются они степенью функциональных расстройств нервно-мышечного аппарата мочевого пузыря. У мужчины появляется необходимость встать 1-2 раза ночью, чего раньше никогда не наблюдалось. В формировании этих симптомов аденомы предстательной железы принимают участие симптомы нарушения функции детрузора. В настоящее время выявлено, что с возрастом, в результате гемодинамической и гормональной перестройки у мужчин, развивается гипоксия гладкой мускулатуры мочевого пузыря. Это приводит к так называемой нестабильности мочевого пузыря с соответствующей ирритативной симптоматикой. Ирритативные симптомы хотя и значительно снижают качество жизни, менее опасны и могут быть значительно уменьшены при правильном консервативном лечении. Однако, как правило, обструктивные и ирритативные симптомы в той или иной степени могут наблюдаться у одного и того же больного, и нет прямой зависимости между выраженностью этих проявлений и тяжестью состояния по данным объективного обследования. Обструктивные симптомы аденомы: затрудненное начало мочеиспускания, струя мочи у больных тонкая, «вялая» и прерывистая. Больной вынужден тужиться для осуществления мочеиспускания, отмечает ощущение неполного опорожнения мочевого пузыря. Большую роль в формировании симптомов аденомы предстательной железы играет наличие сопутствующего воспалительного процесса в простате, встречающегося у 70-87% больных. Сопутствующий хронический простатит проявляется дизурией (расстройствами мочеиспускания), а при отеке ткани предстательной железы - затруднением мочеиспускания, нарушением эректильной функции. Кроме того, его наличие ведет к росту числа ранних и поздних послеоперационных осложнений. Таким образом, в формировании клинической картины аденомы простаты принимают участие патологические процессы, происходящие в предстательной железе и мочевом пузыре, и не всегда связанные с собственно гиперплазией предстательной железы. Следовательно не все больные нуждаются в оперативном удалении гиперплазированной доброкачественной железы. Тем более, что у больных с умеренно выраженными обструктивными симптомами после оперативного лечения существенного улучшения не наступает. Установление диагноза доброкачественной гиперплазии предстательной железы в типичных случаях не представляет затруднений. В последние десятилетия во всем мире наметилась тенденция к формированию единых принципов оценки и интерпретации симптомов аденомы простаты. В практической урологии довольно широкое распространение получило деление симптомов на симптомы обтурации и ирритативные, то есть симптомы раздражения. Все обтурационные симптомы свидетельствуют о сдавлении шейки мочевого пузыря и простатического отдела уретры увеличенной предстательной железой и невозможностью опорожнения последнего с последующим накоплением остаточной мочи. Крайним проявлением такого состояния является парадоксальная ишурия. Выделение обструктивных симптомов и определение остаточной мочи могут служить основой для предварительного представления о заболевании, тактики лечения и прогнозе. В настоящее время разработана шкала симптомов при заболевании предстательной железы (I-PSS), которая позволяет количественно оценить степень их выраженности самим больным. Этот опросник, являясь чрезвычайно простым, получил широкую поддержку урологов многих стран мира. Система суммарной оценки симптомов при заболеваниях простаты (I-PSS) представляет собой анкету, которую предлагается самостоятельно заполнить пациенту. Он должен ответить на 7 четких вопросов, выбирая один из шести ответов в зависимости от выраженности каждого отдельного симптома от 0 до 5 баллов. По результатам анкетирования пациенты разделяются на 3 группы: 0-7 баллов - с легкой симптоматикой; 8-19 баллов - с умеренной симптоматикой; 20-35 баллов - с тяжелой симптоматикой. По сравнению с данными Американской ассоциации урологов, в России преобладает процент лиц с тяжелой симптоматикой. Физикальное обследование включает в себя обязательное пальцевое ректальное обследование. Ректальный осмотр пациента доступен для каждого врача в любых условиях. У большинства мужчин каждая доля железы соответствует по размерам ногтевой фаланге пальца. Железа свободно обводится пальцем, консистенция ее равномерна, границы четкие, легко дифференцируются от окружающих тканей. Очень важно так же выполнять и наружный осмотр и пальпацию живота, так как довольно часто выявляется хроническая задержка мочеиспускания или перкуторно (простукиванием пальцами) и пальпаторно (прощупыванием) определяется мочевой пузырь. В течении заболевания возникают многочисленные осложнения: гематурия (моча с кровью), острая задержка мочи, разнообразные воспалительные явления на фоне нарушения уродинамики верхних и нижних мочевых путей. Гематурия при аденоме простаты встречается довольно часто и может быть микро- и макроскопической, инициальной, терминальной и тотальной. Возникновение ее связано с венозной гипертензией в сосудах малого таза и с варикозными и склеротическими изменениями вен шейки мочевого пузыря. При возникновении гематурии необходимо исключать камни и опухоли мочевого пузыря, а так же опухоли верхних мочевых путей. Острая задержка мочеиспускания может наблюдаться на любой стадии заболевания. Она обычно связана с переохлаждением или перегреванием организма, приемом алкоголя или нарушением функции кишечника. Воспалительные осложнения могут выйти на первый план или усугубить течение заболевания. Цистит и пиелонефрит, возникая на фоне прогрессирующего нарушения уродинамики, становятся хроническими и могут привести к развитию почечной недостаточности. Среди других воспалительных осложнений аденомы простаты следует упомянуть уретрит, простатит, эпидидимит и везикулит. Наибольшее количество больных аденомой предстательной железы имеет смешанные симптомы, когда на фоне учащенного мочеиспускания днем и ночью отмечается истончение струи мочи, появляется остаточная моча и симптомы хронической почечной недостаточности. Поэтому во всех случаях необходимо проводить полное обследование больных. Основным методом лечения аденомы простаты остается оперативный метод. Он показан всем больным, у которых выявлена инфравезикпльная обструкция, при этом успех операции во многом зависит от стадии заболевания и наличия осложнений. К сожалению, очень большой процент больных обращается за помощью на поздних стадиях заболевания при наличии грубых нарушений уродинамики вплоть до острой задержки мочи и нарушения функции почек. В таких случаях для проведения успешной радикальной операции требуется длительная подготовка. В первую очередь для нормализации оттока мочи выполняется цистостомия - создание наружного свища мочевого пузыря хирургическим путем. Эта простая операция в сочетании с противовоспалительным лечением позволяет значительно улучшить состояние больных, нормализовать функцию почек и уменьшить количество послеоперационных осложнений. - задержка мочеиспускания (невозможность опорожнить мочевой пузырь после хотя бы одной попытки катетеризации);- повторная массивная гематурия, обусловленная ДГП;- почечная недостаточность, обусловленная ДГП;- камни мочевого пузыря вследствие ДГП;- повторные инфекции мочевых путей, обусловленные ДГП;- большие дивертикулы мочевого пузыря, обусловленные ДГП. Радикальная операция по поводу аденомы предстательной железы, выполняемая трансуретральным или открытым доступом, должна выполняться в плановом порядке после полного клинического обследования. Многие больные стараются любыми средствами отсрочить операцию, с энтузиазмом встречая каждое новое средство для консервативного лечения аденомы простаты. Часто они пренебрегают относительными показаниями к операции и ждут абсолютных показаний, одним из которых, самым распространенных является острая задержка мочеиспускания. По этой причине, практически каждый третий больной с аденомой предстательной железы начинает лечение с наложения надлобкового мочевого свища по поводу острой или хронической задержки мочеиспускания. Наличие инфравезикальной обструкции является показанием для оперативного лечения. "Золотым стандартом" в лечении аденомы простаты во всем мире является трансуретральная резекция предстательной железы. Применение перидуральной анестезии резко снизило количество противопоказаний для оперативного лечения. ТУР выполняется больным, у которых объем предстательной железы достигает до 60 куб. При большем объеме, который измеряется при УЗИ ректальным датчиком, показана открытая операция - аденомэктомия. Одно время в литературе проводилась мысль о порочности и недопустимости цистостомии, хотя сейчас мы с уверенностью можем сказать, что у ряда больных эта операция является абсолютно показанной. Она необходима для выведения больных состояния интоксикации и проведения санации мочевыводящих путей, а так же для предоперационной подготовки больного (сердце, легкие, и т.д.). Эффект цистостомии превышает все неудобства, связанные с временным наличием надлобкового дренажа. При обращении больного с острой задержкой мочеиспускания и установлении диагноза аденомы доброкачественной гиперплазии предстательной железы (после ректального осмотра) дежурному хирургу рекомендуется решить вопрос о возможности радикальной операции в ближайшее время. Если нет противопоказаний для ТУР или аденомэктомии, следует по возможности быстрее направить больного на радикальную операцию. Не рекомендуется проводить катетеризацию мочевого пузыря более двух суток, так как происходит инфицирование уретры и мочевого пузыря, существенно осложняющее послеоперационный период. Если имеются противопоказания для выполнения радикальной операции (состояние сердечно-сосудистой системы, легких, признаки почечной недостаточности, инфекция мочевых путей), следует выполнить цистостомию, возможно пункционную, и провести соответствующую предоперационную подготовку. Хирургическое вмешательство остается наилучшим и единственным выбором для пациентов, у которых развились серьезные осложнения аденомы простаты. Почти каждый четвертый больной после ТУР отмечает учащенное мочеиспускание, 15,5% - не удерживают мочу, а остаточная моча определяется у 6,2% больных. В связи с этим определены следующие абсолютные показания к оперативному лечению: задержка мочеиспускания (невозможность опорожнить мочевой пузырь после хотя бы одной попытки катетеризации), повторная массивная гематурия, обусловленная доброкачественной гиперплазией простаты, почечная недостаточность, обусловленная аденомой, камни мочевого пузыря вследствие аденомы, повторные инфекции мочевых путей, обусловленные аденомой, большие дивертикулы мочевого пузыря, обусловленные аденомой простаты. В остальных случаях может быть показано консервативное лечение, одним из видов которой является медикаментозное лечение. Медикаментозное лечение аденомы в основном симптоматическое. Для лечения доброкачественной гиперплазии предстательной железы применяют препараты: му)и сказали, что по-жизненно. Я понимаю, что возраст и сопутствующие заболевания, но на ноги мы его поставили, он сам ходит, ест, в ясном сознании, а проблема с этой трубкой заставляют его депрессировать. Неужели ничего нельзя сделать, чтобы избавиться от этой трубки???? Подскажите, а то я устала стучаться в закрытые двери. Так хочется помочь самому доброму, честному, самому лучшему отцу на свете!!! у меня аденома предстательной железы в 2002 году был 28 мм.

Next

Аденома простаты злокачественная опухоль лечение

Крови к моче. Выделяют макрогематурию видна невооруженным глазом и микрогематурию эритроциты обнаруживают под микроскопом или с помощью тестполосок. Удалось видоизменить белок, который входит в состав оболочки вируса и расщепляется только в присутствии вещества, выделяемого опухолью простаты. Видоизменение белка позволило уменьшить количество вируса, необходимое для лечения. Читать полностью Протонная терапия – это новое направление в лучевой терапии, открывшее большие возможности для борьбы с локализованным раком простаты. По сравнению со стандартной радиотерапией и брахитерапией протонная терапия действует более точно и с меньшими побочными эффектами. Скрыть Рак предстательной железы – форма рака, развивающегося в предстательной железе. Предстательная железа или простата принадлежит мужской репродуктивной системе. Основные функции железы – частичное производство семенной жидкости (около 30% общего объема), а также участие в процессе семяизвержения. Способность мужчины удерживать мочу тоже связана с функцией простаты. Чаще рак простаты диагностируют у мужчин в возрасте 55-60 лет и старше. По заболеваемости в Украине рак простаты занял четвертую позицию. Каждый год регистрируют приблизительно 6.5 тысяч новых случаев. Особенность рака простаты заключается в том, что злокачественное образование развивается очень медленно. В начальной стадии заболевание может протекать без каких-либо заметных симптомов. При установлении диагноза рака предстательной железы могут быть обозначены следующие этапы. УЗИ простаты – информативный и безвредный метод диагностики, не требующий от пациента серьезной подготовки и затрат времени. УЗИ простаты, как метод объективной визуализации, широко используется в первичной диагностике заболеваний предстательной железы. Для подтверждения рака простаты, как правило, проводится биопсия предстательной железы и дальнейшее гистологическое исследование материала. Дальнейшие исследования, такие как компьютерная томография (КТ простаты) и остесцинтиграфия, могут быть выполнены, чтобы определить степень распространения рака простаты. Существуют различные варианты лечения рака предстательной железы, которые, прежде всего, зависят от стадии заболевания: Основные методы лечения – это хирургический, в том числе ТУР простаты (трансуретральная резекция предстательной железы), лучевая терапия (радиотерапия рака простаты) или динамическое наблюдение. Другие виды лечения, такие как гормональная терапия (гормонотерапия рака простаты), химиотерапия применяются в зависимости от клинического сценария и желаемого результата. Применение гормонотерапии на далеко зашедших стадиях заболевания дает хорошие результаты. А использование гормонотерапии при лечении ранних форм рака простаты малоэффективно, как показали современные исследования. Если на поздних стадиях обнаруживают рак предстательной железы, лечение его заключается в применении гормональной терапии, которая в таких случаях играет важную роль. Целью гормональной терапии является блокирование воздействия мужского полового гормона (тестостерона) на клетки простаты. Гормональная терапия играет важную роль в лечении поздней стадии рака простаты. При локализованном раке предстательной железы оптимальным методом лечения является радикальная простатэктомия – радикальное удаление простаты. Основные принципы гормональной терапии заключаются либо в подавлении продукции тестостерона в организме мужчины, либо в предотвращении его воздействия на ткани предстательной железы. Возможно менее травматичное эндоскопическое удаление простаты. При этом одним из показателей к выбору данного лечения является ожидаемая продолжительность жизни не менее 10-15 лет после вмешательства. ТУР простаты – это эффективный метод лечения данного вида рака. В ЛІСОД, по показаниям, проводится дистанционная лучевая терапия. После операции, по показаниям, возможно проведение гормональной терапии. Дистанционная радиотерапия в ЛІСОД выполняется на линейных ускорителях американской фирмы VARIAN. Индивидуальное планирование, компьютерная симуляция облучения, использование мультилепестковых коллиматоров позволяет свести к минимуму вероятность побочных явлений. Решение о наблюдении или лечении локализованного рака предстательной железы обсуждается с пациентом. Оно является компромиссом между ожидаемыми полезными и вредными последствиями с точки зрения выживаемости больных и их качества жизни. Рак простаты может вызвать боль, затрудненное мочеиспускание, проблемы при половом акте, эректильную дисфункцию. Перечисленные симптомы могут вызывать и простатит, и доброкачественные опухоли простаты (аденома простаты), и увеличение простаты (гиперплазия простаты). Простатит – это самое распространенное урологическое заболевание у мужчин: воспаляется предстательная железа. Симптомы рака простаты похожи на симптомы гиперплазии простаты. Диагностика рака простаты в ЛIСОД проводится с использованием новейшей аппаратуры. Рак предстательной железы симптомы проявляет очень тяжелые, когда заболевание уже на поздней стадии. Часто метастазы рака простаты в кости проявляются болью. Интенсивность боли у разных людей может быть различной. Рак предстательной железы распространяет метастазы в печень, надпочечники, легкие, кости (позвоночник, таз, бедра). Важно понимать, что метастазы рака простаты в кости не означают развитие рака костной ткани у больного. В таких случаях – это именно рак предстательной железы с метастазами в кости. Но могут быть и ранние метастазы – даже небольшая опухоль распространяется в другие ткани и органы. Проблема в том, что рак простаты симптомы проявляет обычно тогда, когда заболевание зашло слишком далеко. Следует понимать, что рак простаты 4 степени требует очень сложного и длительного лечения. Частота возникновения рака простаты в мире варьируется. В Восточной и Южной Азии рак предстательной железы обнаруживают значительно реже, чем в Европе. Основные причины: Генетическая предрасположенность В США рак предстательной железы чаще встречается у чернокожих, чем белых или латиноамериканских мужчин. Мужчины, у которых есть рак предстательной железы в анамнезе ближайших родственников, имеют в два раза выше риск развития этого заболевания. Исследования близнецов в странах Скандинавии позволили предположить, что 40 процентов риска можно объяснить факторами генетической предрасположенности. В тоже время, нет одного гена, ответственного за возникновение рака предстательной железы. Различные гены могут быть причастны к развитию этого заболевания: в частности, мутации генов BRCA1 и BRCA2. Другие гены, которые включены в понятие "ген рака простаты", – это гены андрогенных рецепторов, витамин Д рецепторов, а также ген HPC1. Диета Есть исследования, которые доказывают, что насыщенная жирами калорийная пища способствует возникновению рака предстательной железы. Велик риск у мужчин, употребляющих в большом количестве мясо, молоко, яйца, сыр. Риск также повышается при низком уровне витамина Д в крови, что, как правило, связано с отсутствием воздействия ультрафиолета. Доказано, что постоянное употребление в пищу брокколи, цветной капусты или других крестоцветных овощей уменьшает риск на 40%. Фитохимические вещества diindolylmethane и индол-3-карбинол, обнаруженныее в крестоцветных овощах, имеют иммуномодулирующие и антиандрогенные свойства. В разделе публикуются вопросы пациентов и ответы наших специалистов. Вопрос каждого человека касается конкретной проблемы, связанной с его заболеванием. Пациентам отвечают израильские клинические онкологи и главный врач ЛIСОД, д.м. Ответы специалистов основаны на знаниях принципов доказательной медицины и профессиональном опыте. Ответы соответствуют исключительно предоставленным сведениям, имеют ознакомительный характер и не являются врачебной рекомендацией. Основная цель раздела – дать информацию пациенту и его семье, чтобы вместе с лечащим врачом принять решение о виде лечения. Предложенная Вам тактика лечения может отличаться от принципов, изложенных в ответах наших специалистов. Из Вашего описания неясно, выполнялась ли рентгенография легких и остеосцинтиграфия (изотопное сканирование костей). Не стесняйтесь задать лечащему врачу вопрос о причинах отличий. Днепропетровска поставлен диагноз: умереннодифференцированная аденокарцинома простаты(сумма Глисона3 3=6)Т1с N0M0 основанном на результатах биопсии сделанной в г. В случае, если результаты вышеуказанных исследований не имеют признаков метастазирования, тогда рекомендованное Вам лечение, в целом, верное. Вы должны быть уверены, что получаете правильное лечение. Киев в CSD, ( сумма Глисона3 3=6) всех 3-х кусочках занято 17% . Томографией не обнаружено каких-то негативных изменений в органах брюшной полости и малого таза. Более четко на Ваши вопросы может ответь онколог на приеме. Простата типичной формы 48х42мм, с четкими, бугристыми контурами, практически однородной структуры... Рекомендовано: Золадекс, дефинитивна лучевая терапия,либо радикальная простатэктомия.

Next

Аденома простаты злокачественная опухоль лечение

Лечение аденомы предстательной железы или. даже злокачественная опухоль обычно. Железа простаты — второстепенная часть мужских репродуктивных органов, расположенная под мочевым пузырем, вокруг его шейки. Заболевания предстательной железы чаще всего тревожат мужчин после 35 лет. Без лечения простатит может перетечь в хроническую форму. Также возможны следующие осложнения: абсцесс, цистит, пиелонефрит, аденома простаты, импотенция, бесплодие. Лечение предстательной железы у мужчин какими народными средствами может помочь? Воспаление начинается со слизистой оболочки выводных протоков железистой доли. Вирус проникнет в ткань и будет способствовать появлению множества маленьких гнойников. Если эти гнойники сольются в один большой, получится абсцесс простаты. Для острого простатита характерны сначала учащенное мочеиспускание, которое сопровождается болью. Температура при остром простатите может повышаться выше 40 градусов, будет сопровождаться слабостью и ознобом. При немедленно начатом лечении прогноз заболевания бывает благоприятным. Лечение простатита и других заболеваний предстательной железы травами и прочими народными средствами проводят, если нет осложнений или если воспаление хроническое. Народные методы повышают сопротивление организма инфекциям и облегчают боль. Рассмотрим следующие эффективные рецепты: Пациент должен лечь на бок, подтянуть колени к туловищу или наклониться и принять коленно-локтевое положение. Специалист надевает перчатку, смазывает ее вазелином, вводит указательный палец в прямую кишку, нащупывает простату (3-5 см от сфинктера). Чем больше запущено заболевание, тем больнее процедура. Предварительно стоит очистить кишечник, а мочевой пузырь оставить наполненным. Выполнять процедуру до двух минут один-два раза в день. Если в ходе процедуры выделилось около 4-5 капель секрета железы, массаж эффективен. Цвет выделяемой жидкости должен быть прозрачным, немного беловатым. Желтый или другой оттенок свидетельствует о наличии гноя. Физические упражнения для предстательной железы улучшают кровоснабжение простаты и уменьшают отечность.

Next

Андрей Каприн Не надо бояться аденомы простаты, с ней. МК

Аденома простаты злокачественная опухоль лечение

Ведь не удалять такую аденому нельзя? — Нет, не так. Есть огромное количество и хирургических, и консервативных методов лечения простаты. Если речь идет о доброкачественной опухоли, то достаточно убрать только растущую ткань, не удаляя всю железу. Золотым стандартом. Одним из тяжелых и, к сожалению, распространенных заболеваний является опухоль простаты у мужчин. Патология встречается в возрастной группе старше 65 лет и обусловлена, в первую очередь, возрастными изменениями. Прогноз на выздоровление зависит от типа новообразования. Независимо от типа заболевания, причина его развития кроется непосредственно в мужской физиологии. Точные причины опухоли неизвестны, однако врачи выдвигают гормональную теорию. По мнению специалистов, опухоли этого органа развиваются вследствие снижения выработки тестостерона, при сохранении синтеза его производной – дигидротестостерона. Излишек этого вещества поглощаются предстательной железой, в результате чего ее размеры увеличиваются до размеров опухоли. Немаловажную роль в развитии опухолевых новообразований играет генетическая предрасположенность. Факторы, предрасполагающие к развитию патологии: Заболевание длительное время протекает бессимптомно, что затрудняет своевременную постановку диагноза и лечение. Диагностика опухоли затруднена отсутствием специфических симптомов на начальных стадиях. При увеличении простаты в размере появляется болевой синдром, что обусловлено давлением органа на окружающие ткани. Тем не менее дискомфорт отмечается только на поздних стадиях. Заподозрить развитие опухоли можно, заметив учащенные позывы к мочеиспусканию. Как правило, дискомфорт после мочеиспускания при опухоли отсутствует, в отличие от простатита. Неспецифические симптомы – это нарушение потенции или ослабление эрекции. При этом какие-либо болевые ощущения во время полового акта и после семяизвержения могут полностью отсутствовать. В редких случаях, вместо дискомфорта в промежности, мужчину могут беспокоить боли в нижнем отделе позвоночника. Достаточно часто при этом возникает недержание мочи, что обусловлено нарушением работы мочевыводящей системы. Это вещество выделяется в кровь только при образовании опухоли в предстательной железе. Незначительное повышение показателя, не превышающее 10-15 единиц, позволяет диагностировать простатит или доброкачественное новообразование. О злокачественном процессе свидетельствует высокий уровень этого белка, свыше 50 единиц. При подозрении на опухолевый процесс, когда симптомы заставляют насторожиться, назначается МРТ предстательной железы и УЗИ органа. Эти методы позволяют определить локализацию измененных клеток и предположить тип опухоли в органе. Доброкачественная опухоль простаты – это аденома иди ДГПЖ. С аденомой сталкивается примерно 25% мужчин старшего возраста. Патология значительно ухудшает качество жизни, однако не является раком. Тем не менее, при аденоме важно своевременное лечение, в противном случае существует риск перерождения клеток гиперплазии в злокачественные. Злокачественная опухоль простаты или рак – это опасное заболевание, требующее принятия радикальных мер. Для лечения применяется химиотерапия, при отсутствии противопоказаний показано удаление новообразования или предстательной железы полностью. Заметив первые симптомы, важно своевременно пройти диагностику для исключения злокачественной опухоли. Доброкачественная опухоль простаты лечится медикаментозно. Для этого применяют лекарственные средства группы альфа-адреноблокаторов и простатопротекторы. Медикаментозная терапия направлена на уменьшение симптомов, улучшение функциональности органа и уменьшение скорости прогрессирования заболевания. Последнее достигается путем приема лекарств антиандрогенного действия. Из народных средств применяется лечение семенами тыквы. Семечки содержат вещества, положительно влияющие на предстательную железу, за счет снижения выработки дигидротестостерона и улучшения трофики органа. Препараты группы альфа-адреноблокаторов применяют для нормализации мочеиспускания. Эти лекарства расслабляют мочевой пузырь и помогают избежать задержки мочи. В ряде случаев, когда гиперплазия нарушает отток мочи, проводится катетеризация мочевого пузыря. На поздних стадиях гиперплазии или аденомы применяются хирургические методы лечения. Они показаны пациентам, которым не удается уменьшить симптомы заболевания при медикаментозном лечении за счет длительного течения заболевания. Способы операций при аденоме: Лазерное воздействие практикуется на начальных стадиях при небольших размерах опухоли. При аденоме простаты операция с помощью лазера – это щадящий метод лечения, который заключается в послойном удалении ткани гиперплазии, и не затрагивает здоровые ткани органа. Трансуретральная резекция подразумевает удаление гиперплазии посредством доступа к органу через уретру. Радикальная простатэктомия – это полное удаление предстательной железы. На начальных стадиях полное удаление органа не целесообразно, а на поздних – не безопасно, так как аденома прогрессирует долго, и средний возраст пациентов с выраженной гиперплазией – это старше 75 лет. Для лечения рака предстательной железы, в первую очередь выбирается выжидательная тактика. На протяжении нескольких месяцев онколог с урологом наблюдают за самочувствием пациента и состоянием опухоли. Такая тактика оправдана при раке простаты у мужчин пожилого возраста (старше 70 лет). Какие-то радикальные методы в этом случае могут привести к негативным последствиям для здоровья. Если опухоль быстро растет, пациенту показан курс химиотерапии. Пациентам со злокачественным новообразованием часто назначают внутритканевую химиотерапию, во время которой радиоактивные препараты, уменьшающие рост клеток, поставляются непосредственно к предстательной железе. Еще один метод лечения – это гормональная кастрация. Он основан на приеме специальных препаратов, угнетающих выработку мужских гормонов, что останавливает скорость прогрессирования заболевания. Недостаток гормональной терапии заключается в том, что принимать ее необходимо пожизненно, но не все пациенты хорошо переносят такие лекарственные средства. Радикальный способ лечения – это простатэктомия, то есть полное удаление предстательной железы и лимфатических узлов. Операцию предпочтительно проводить на ранних стадиях развития онкопатологии, так как в этом случае выживаемость среди пациентов достигает рекордных 90%. При аденоме длительность жизни не сокращается, но вот качество страдает. Многие пациенты предпочитают удалить простату после многолетней борьбы с аденомой медикаментозными средствами. При раке простаты прогноз зависит от своевременности лечения. Сколько живут пациенты можно предугадать, в зависимости от стадии заболевания. При полном удалении простаты на первой стадии рака, длительности жизни достигает 10-15 лет, но с условием регулярного обследования и приема специальных препаратов. Если предстательную железу удалили на стадии начала развития метастаз – жить пациенту остается около 5-7 лет. Количество пациентов, проигравших раку, неумолимо растет из года в год, что связано, в первую очередь, с отсутствием своевременного лечения из-за того, что мужчина не обращается к врачу. Важно помнить: своевременно обнаруженный рак победить реально. Сколько проживет мужчина – это зависит от того, насколько быстро он среагирует на тревожные симптомы и обратится к врачу. Не допустить развития злокачественного или доброкачественного новообразования очень сложно. Специфической профилактики этих заболеваний не существует. Заметив незначительный дискомфорт, нарушение мочеиспускания или боль в промежности, необходимо как можно раньше посетить уролога.

Next

Инициальная гематурия это. Что такое инициальная гематурия?

Аденома простаты злокачественная опухоль лечение

Крови в моче определяется невооруженным глазом, говорят о макрогематурии; если эритроциты обнаруживаются только при исследовании под микроскопом –. Чаще диагностируется у мужчин негроидной расы, у азиатов – реже всего. Поэтому карциному обнаруживают у мужчин случайно в ходе обследования по поводу других заболеваний мочеполовой системы, органов малого таза. В сложных ситуациях отток мочи становится невозможным, поскольку проток перекрывается. Повреждение чувствительных нервов, ведущих к половым органам, ведет к импотенции. Когда рак простаты распространяется на прямую кишку, мужчина чувствует боль при опорожнении кишечника, часто жалуется на запоры. При метастазировании опухоли в кости появляются боли в позвоночнике, костях таза. Если метастазы поразили печень, пациенты сталкиваются с желтизной кожных покровов, болью в правой стороне ребер. Сухой кашель без причин может говорить о метастазах в легких. На первой стадии опухоль еще слишком мала – ее микроскопические размеры не дают возможность прощупать ее при пальпаторном либо ультразвуковом исследовании. На второй стадии опухоль уже более крупная, но пока еще находится в пределах простаты, ограничена ее капсулой. Врач во время пальцевого исследования может нащупать опухоль, которая представляет собой плотный узелок. Рак 2 степени можно увидеть на УЗИ, симптомы на этой стадии проявляются нарушенным мочеиспусканием по причине того, что простата давит на уретру. Мочеиспускание вялое, в промежности возникают боли и рези. Ночью мужчине приходится вставать в туалет несколько раз. В отдаленные органы метастазы пока не доходят, поэтому симптомы касаются локальных ощущений. На 3 стадии рака мужчина испытывает сложности с потенцией, в пояснице и лобке часто ощущает боль. При мочеиспускании ощущается жжение, в моче выявляется кровь. На четвертой стадии развития карцинома значительно увеличивается в размерах, дает метастазы в отдаленные органы (печень, кости, лимфоузлы легкие), в связи с чем симптоматика может касаться локализации вторичных опухолей. Пациент ощущает слабость и бессилие на фоне сильной интоксикации. Из-за невозможности помочиться мужчинам устанавливают в уретру катетер. Это значит, что пожилым пациентам нецелесообразно начинать радикальное лечение опухоли. В таком случае назначается лишь поддерживающая терапия. Рак простаты – не приговор, особенно на ранней стадии. Если выявить его в самом начале, можно достичь полного выздоровления либо стойкой ремиссии. Даже на поздних стадиях правильно подобранное лечение позволяет добиться хороших результатов и продлить жизнь пациентов. Общие рекомендации профилактики позволяют снизить риск возникновения патологических состояний любого характера.

Next

Аденома простаты злокачественная опухоль лечение

Как и другие злокачественные опухоли, рак простаты имеет тенденцию к метастазированию распространению по организму. пожилой возраст;; плохую наследственность близкие родственники больны раком простаты;; имеющуюся прогрессирующую аденому простаты;; плохую экологию;; работу с. Многие симптомы, характерные для аденомы предстательной железы, присущи не только ей — они могут возникать и при других урологических заболеваниях. Врач проведет пальцевое ректальное исследование предстательной железы, позволяющее определить её размер, плотность и консистенцию. Пальцевое ректальное исследование обычно дополняют ультразвуковым исследованием предстательной железы. Уродинамические исследования (урофлоуметрия, видеоуродинамика) составляют неотъемлемую часть обследования больных с нарушениями мочеиспускания. Они помогают урологу определить характер и степень расстройств мочеиспускания, установить причину появившейся симптоматики, оценить функциональное состояние нижних мочевых путей. Урофлоуметрия на сегодняшний день является обязательным методом уродинамического обследования пациента, предъявляющего жалобы на изменение характера мочеиспускания. Таким образом, урофлоуметрия — это метод измерения потока мочи, позволяющий определить объемную скорость мочеиспускания. Термин «урофлоуметрия» произошел от двух греческих слов и одного английского (греч— моча, англ. В настоящее время существует множество электронных приборов для проведения урофлоуметрии, в том числе и в домашних условиях. Остальные уродинамические исследования проводятся строго под контролем врача-уролога в стационаре в специально оборудованных кабинетах. Необходимые уродинамические исследования и оцениваемые при этом показатели определяются врачом-урологом индивидуально. В настоящее время обязательным исследованием при подозрении на аденому простаты является определение уровня простат-специфического антигена (ПСА). Этот маркер позволяет наблюдать за течением заболевания, а также вовремя диагностировать рак предстательной железы. Лечение аденомы простаты проводят в поликлинике или в стационаре, в зависимости от стадии заболевания и возникших осложнений. На поздних стадиях и при развитии осложнений может потребоваться хирургическое вмешательство. Лекарства при аденоме простаты Цель лекарственной терапии: замедлить рост простаты, уменьшить ее объем и выраженность нарушений мочеиспускания. При таком эндоскопическом вмешательстве снижается риск осложнений и уменьшается послеоперационный период. На сегодняшний день при необходимости хирургического лечения предпочтение отдается именно этой операции. – метод удаления предстательной железы «открытым» хирургическим вмешательством. Отличается от ТУР большей травматичностью и длительным периодом реабилитации. Лечение аденомы простаты без операции На сегодняшний день существуют, так называемые, малоинвазивные методы лечения аденомы простаты. – уменьшение размера аденомы под воздействием высоких температур. Для нагревания ткани простаты чаще всего используют микроволновое, радичастотное излучение, ультразвук. Трансуретральная микроволновая термотерапия – наиболее распространенный термальный метод. - лазерное излучение нагревает воду в ткани простаты, происходит испарение (вапоризация) воды, и одновременно коагуляция (сворачивание) ткани простаты. Трансуретральная вапоризация простаты – наиболее распространенный термальный метод. Стент представляет собой каркас в виде цилиндра из полимерного материала, который препятствует сужению просвета уретры. Обычно баллоная дилатация и стентирование используются одновременно. Такие малоинвазивные методы более безопасны, чем хирургическое вмешательство, но менее эффективны.

Next

Рак простаты у мужчин симптомы и лечение

Аденома простаты злокачественная опухоль лечение

Симптомы рака предстательной железы. лечения рака простаты. злокачественная опухоль. Что такое ДГПЖ (аденома простаты) и рак предстательной железы? В течение жизни у большинства взрослых мужчин в генах клеток предстательной железы накапливаются мутационные изменения, приводящие к увеличению размеров простаты или её злокачественному перерождению. Физическая карта хромосом с указанием расположения генов, в которых при заболеваниях предстательной железы обнаруживают мутации Подобное увеличение предстательной железы носит название "доброкачественная гиперплазия простаты" и вызывает различные нарушения функционирования мочевыводящих путей, степень выраженности которых зависит от стадии гиперплазии. Количество мутаций различное у каждого конкретного больного. 1 показаны участки хромосом, в которых возникают мутации при доброкачественных и злокачественных заболеваниях предстательной железы. Если при увеличении простаты происходит гиперплазия главным образом железистой ткани, заболевание называют "аденома простаты". ДГПЖ или аденома простаты наблюдаются примерно у 20% мужчин в возрасте 40 лет, 70% мужчин в возрасте 60 лет и у 90% мужчин в возрасте 80 лет и старше [1, 19, 37, 38]. Поскольку рост простаты обычно происходит довольно медленно, у большинства мужчин не возникает никаких клинических проявлений заболевания, однако примерно у трети из них нарушение самочувствия заставляет обращаться за медицинской помощью. Ранние клинические проявления ДГПЖ или аденомы простаты (ослабление струи мочи, учащение мочеиспускания (как днем, так и ночью – никтурия), недержание мочи и импотенция) могут колебаться от незначительно выраженных до умеренных. При прогрессировании заболевания аденома простаты вызывает изменения мочевыводящих путей и почек. Увеличивающаяся в размерах аденома приводит к значительному удлинению и сдавлению уретры, что может привести к выраженному растяжению мочевого пузыря вследствие рефлюкса мочи, тяжелым расстройствам мочеиспускания (учащению и затруднению), присоединению инфекций мочевого тракта, почечной недостаточности и острой задержки мочи (дизурии), требующей экстренной катетеризации мочевого пузыря. В случае быстрого прогрессирования заболевания может понадобиться немедленное хирургическое вмешательство. The probability that the patient has 1) completely organ-confined disease 2) established capsular penetration 3)extension of his prostate cancer into his seminal vesicles. Наиболее вероятными предшественниками рака предстательной железы считаются аденома простаты и внутриэпителиальная неоплазия предстательной железы. 4) prostate cancer which has spread into his lymph nodes. Внутриэпителиальная неоплазия предстательной железы является пролиферативным повреждением, т. состоит из клеток эпителия простаты, которые делятся быстрее, чем нормальный эпителий. Однако эти клетки еще не стали опухолевыми [22, 23]. Patient Information PSA (prostate-specific antigen) Screening for Prostate Cancer. Рак предстательной железы Рак предстательной железы – вторая по частоте причина смерти мужчин вследствие злокачественных новообразований, уступая только раку легких. Radical prostatectomy often results in impotence and urinary incontinence. По предварительной оценке американского общества борьбы с раком, в течение 2003 года в США будет диагностировано 220 900 новых случаев рака простаты, и 28 900 мужчин умрут от этого заболевания. Рак предстательной железы в течение жизни диагностируют у одного мужчины из шести. Среди мужчин, умерших от рака, 10% умирает именно от рака предстательной железы [3]. У пациентов с ДГПЖ или аденомой простаты рак предстательной железы наблюдается главным образом после 40 лет. Однако, в отличие от ДГПЖ, при раке изменения возникают в любой ткани простаты, а не только в железистых структурах, поэтому злокачественная опухоль может развиться и в неизмененной в размерах, увеличенной или оперированной предстательной железе. Кроме того, в одной и той же простате могут наблюдаться одновременно и рак, и аденома. The Doctor's Doctor, PSA (prostate specific antigen). На ранних стадиях рак предстательной железы не вызывает каких-либо специфических симптомов. Prostate Doctor, Prostate Cancer Diagnosis: What you should know. На ранних стадиях ДГПЖ или аденомы простаты нужно включать пациентов в группу динамического наблюдения ("тревожного ожидания" – "watchful waiting"), при необходимости назначая лекарственные препараты (главным образом гормональные препараты и a-адреноблокаторы), физиотерапевтические процедуры и оперативные вмешательства. Динамическое наблюдение включает в себя ежегодные осмотры, чтобы установить, прогрессируют симптомы заболевания или нет. Это часто дает возможность врачу вовремя назначить медикаментозное или хирургическое лечение. С наибольшим успехом применяют используют празозин (Minipres™), доксазозин (Cardura™), теразозин (Hytrin™), тамулозин (Flowmax™/Omnic™), алфузозин (Xatral™) [25]. Хотя у большинства пациентов с ДГПЖ эти препараты могут улучшить отток мочи, они не в состоянии остановить рост простаты. С другой стороны, для достижения стойкого терапевтического эффекта указанные средства необходимо применять постоянно, что часто вызывает побочные эффекты (головокружение, незначительное снижение артериального давления, ослабление эрекции), а при отмене a-адреноблокаторов клинические симптомы заболевания возвращаются. Термотерапия и лазеротерапия – наиболее эффективные физиотерапевтические процедуры, используемые при лечении ДГПЖ или аденомы простаты. Трансуретральную микроволновую термотерапию проводят с использованием специальных аппаратов (Prostatron™, Targis™, Prostalund™). При этом микроволновая энергия по катетеру доставляется внутрь простаты, вызывая значительное повышение температуры, что приводит к локальному разрушению клеток, уменьшению размеров простаты и улучшению оттока мочи [24, 25, 28, 35, 36]. Высокоэнергетические пучковые применяют при малоинвазивных хирургических вмешательствах. Как и при термотерапии, индуцированная лазером высокая температура вызывает испарение тканевых образований. Для наведения лазерного пучка на простату используют модифицированный цистоскоп или трансректальный ультразвуковой датчик. Наиболее современные и эффективные методики этого вмешательства – лазерное удаление простаты под визуальным контролем (Visual Laser Ablation of the Prostate – VLAP) [30, 31]; контактная лазерная коагуляция, интерстициальная лазерная коагуляция; трансуретральная лазериндуцированная простатэктомия (Trans Urethral Laser-Induced Prostatectomy – TULIP) [32, 36]; гольмиево-лазерная резекция простаты (Ho LRP) [34]. Salvage radical prostatectomy for radiorecurrent prostate cancer: morbidity revisited. К хирургическому лечению прибегают для уменьшения выраженности симптомов на поздних стадиях заболевания. Трансуретральная резекция простаты – наиболее успешное и общепринятое вмешательство при ДГПЖ и считается у урологов "золотым стандартом" эффективности лечения. Операцию выполняют без наружного разреза с помощью специального инструмента – резектоскопа – в течение примерно 90 минут. При небольшом увеличении простаты операцией выбора является так называемое трансуретральное надрезание простаты. Основные преимущества этого метода – быстрота и легкость выполнения при относительно хороших результатах. Недостатки – смещение положения стента, а также учащение опорожнения мочевого пузыря вследствие раздражения из-за манипуляции [25, 36]. Prostate Cancer UK, Prostate-Specific Antigen (PSA). В том случае, если простата достигает больших размеров, выполняют . Конечные результаты при этой операции намного лучше, чем при прочих методах лечения, хотя и очевиден более высокий хирургический риск. Рак предстательной железы В настоящее время при раке простаты применяют весь спектр методов лечения, разработанных для других типов злокачественных опухолей, последовательно переходя от динамического наблюдения, гормональной терапии, химиотерапии, криотерапии, лучевой терапии к радикальным операциям. Выбор оптимального метода лечения должен основываться на оценке клинической стадии и гистологического типа опухоли, количества баллов по шкале Gleason [43, 44, 45], уровня простатоспецифичного антигена (prostate specific antigen – PSA) [42, 47, 48, 49, 51], а также состояния пациента – возраста, социального статуса, наличия или отсутствия сопутствующих заболеваний и т. Существуют таблицы Партина (Partin coefficient tables) [52], в которых дается комплексная оценка уровня PSA, количества баллов по шкале Gleason и клинической стадии рака, разработанные группой урологов из урологического института Брэйди (Brady Institute for Urology) и университета Джона Хопкинса (Johns Hopkins University) (пересмотренные в мае 1997). Их используют для определения стадии рака простаты, что исключительно важно в плане выработки тактики лечения пациента. В группу должны быть включены пациенты с очень ранними стадиями рака простаты, когда количество и размер опухолевых клеток очень малы (что определено оценкой уровня PSA и данных биопсии), а степень злокачественности опухоли низкая (количество баллов по шкале Gleason 6 и менее). Главными преимуществами динамического наблюдения является отсутствие тяжелых побочных эффектов хирургического вмешательства, лучевой терапии или гормонального лечения, а также связанных с лечением расходов. С другой стороны, при такой тактике очевиден риск быстрого роста раковой опухоли в промежутке между контрольными осмотрами [53, 54, 55]. (направленная на подавление образования андрогенов) обычно применяется при поздних стадиях рака простаты и может быть назначена совместно с лучевой терапией или после простатэктомии, особенно при высоком риске рецидивирования. В качестве основного компонента традиционного лечения андрогены используются при наиболее агрессивных опухолях, а также при невозможности осуществления хирургического вмешательства или лучевой терапии. Комбинация гормонотерапии и химиотерапии при лечении рака простаты в настоящее время проходят стадию клинических испытаний [56, 58] с целью оценки ее эффективности. используют главным образом при раке простаты, рефрактерному к гормональной терапии. Наиболее успешным оказалось назначение митаксантрона (Mitaxantronе) совместно с преднизолоном, а также эстрамустина (Emcyt), хотя это лечение и сопровождалось ожидаемыми побочными эффектами – выпадением волос, лейкопенией, анемией и тошнотой [57, 59, 60, 61, 62]. (лечение низкими температурами) или криохирургия [46] считается одним из самых потенциально эффективных современных методов лечения, применяемых для терапии первичной опухоли или рецидивов рака простаты после лучевой терапии. Криотерапия может быть альтернативой лучевой терапии у пациентов с симптомами обструкции мочевыводящих путей, на долгое время устраняя препятствия для оттока мочи. Transurethral resection of the prostate (TURP) for benign prostatic hyperplasia (BPH), Surgery Overview. Отдаленные результаты пока не получены, а побочные эффекты (импотенция и недержание мочи) ограничивает применение криотерапии указанными рамками [46, 64, 65, 66]. Prostate Cancer UK, Transurethral Resection of the Prostate (TURP). – следующее основное традиционное направление в послеоперационном лечении рака простаты. Prostate Cancer UK, BHP (Benign Prostatic Hyperplasia). Схемы лучевой терапии [55, 67, 65] и комбинированного лечения детально разработаны для различных стадий рака простаты. Department of Urology, New York-Presbyterian Hospital Columbia Campus, New York, NY. Именно лучевая терапия является методом выбора для тех групп пациентов, у которых хирургическое вмешательство сопровождается слишком большим риском, например, для пожилых или имеющих тяжелые сопутствующие заболевания людей. С повышением точности направленности лучевой терапии этот метод будет применяться и у молодых пациентов. Однако лучевая терапия далеко не всегда отвечает современным требованиям к лечению заболеваний предстательной железы. Например, при поздних стадиях рака (8-10 баллов по шкале Gleason) лучевая терапия менее эффективна, чем хирургическое вмешательство. Лучевая терапия строго направлена, и при наличии метастазов она не может являться радикальным средством. Наиболее эффективна лучевая терапия при паллиативном лечении костных метастазов рака простаты, главным образом для купирования болевого синдрома. С другой стороны, каким бы прицельным не был пучок радиоактивных лучей, близлежащие ткани также подвергаются облучению, да и неблагоприятное влияние локальной лучевой терапии на весь организм может быть лишь сведено к минимуму, но не устранено полностью. CORNELL Physicians, BPH, Surgical Treatments , Surgery; TURP and TUIP, Minimally Invasive Procedures: Laser prostatectomy, Transurethral thermotherapy, Transurethral needle ablation (TUNA), Prostatic stents, Transurethral electrovaporization. Таким образом, отдаленные побочные эффекты – иммуносупрессия, лейкопения, анемия, тошнота – обусловливают неоднозначность и ограниченность применения этого метода лечения. Как и при других локализациях раковых опухолей, наилучшие отдаленные результаты наблюдаются при радикальном хирургическом лечении – радикальной простатэктомии с сохранением иннервации или без нее. применяют главным образом у относительно молодых пациентов с опухолями стадии Т2 (или 7 баллов по шкале Gleason). Minimally Invasive BPH Treatments , Laser Surgery BPH Treatment, Transurethral Microwave Thermotherapy (TUMT), Transurethral Needle Ablation (TUNA®). Более того, разработанные недавно технологии (вмешательства с сохранением семенных пузырьков, лапароскопические манипуляции) не только сводят к минимуму хирургические осложнения (риск наркоза, опасность кровотечения, хирургическую интра-и послеоперационную смертность) и длительность пребывания пациентов в стационаре, но также значительно удлиняют продолжительность жизни больных раком простаты. Оперативное лечение редко применяется у пациентов старше 70 лет, т. хирургический риск не менее велик, чем возможные благоприятные результаты операции. Holmium: YAG Laser Resection of the Prostate Versus Visual Laser Ablation of the Prostate and Transurethral Ultrasound-Guided Laser Induced Prostatectomy. Отрицательными сторонами хирургического лечения могут оказаться импотенция и неспособность поддерживать эрекцию на достаточном уровне. Хирургическое лечение метастатических и андроген-независимых опухолей простаты применяется ограниченно и в большинстве случаев неудовлетворительно [28, 44, 50, 54]. Современный подход к лечению Достижения применения традиционных методов лечения, описанных выше, ограничены. С одной стороны, врачи руководствуются этими методами уже в течение многих лет, с другой стороны, неуклонно увеличивающееся число заболеваний простаты побуждает исследователей разрабатывать более эффективные альтернативные методы. Среди современных разработок в лечении опухолей можно выделить ангиостатический подход, направленный на прекращение кровоснабжения раковой опухоли, демонстрирующий многообещающие результаты. основана на достижениях молекулярной биологии и генетики и является современным методом лечения рака предстательной железы, главным образом его наиболее агрессивных гистологических типов [10, 16]. В течение последнего десятилетия ученые приступили к разработке сотен иммунотерапевтических препаратов и вакцин, которые находятся на разных этапах клинических испытаний. Одним из таких лекарственных препаратов для лечения рака опухолевых и предопухолевых заболеваний простаты является вакцина РЕСАН. Необходимо отметить, что рак простаты, к сожалению, часто рецидивирует после достаточно успешного традиционного лечения. Поэтому применение вакцины РЕСАН может сыграть уникальную роль в профилактике и лечении рака простаты, спасти и продлить жизнь многим пациентам. Laser Prostatectomy for Benign Prostatic Hypertrophy. может восстановиться иммунологическая реактивность, обеспечивающая борьбу с раком. В последние годы были изучены важнейшие компоненты эффективного иммунного ответа. Понимание механизмов дисфункции одного или нескольких звеньев иммунного ответа привело к появлению различных направлений иммунотерапии: 1) стимуляция пролиферации дендритных клеток; 2) содействие захвату антигена и его процессингу; 3) стимуляция ответа эффекторных клеток при помощи прямой презентации антигена; 4) элиминация раковой опухоли с помощью антител. Именно предстательная железа является уникальным местом приложения для иммунотерапии, т. простатоспецифический иммунитет формируется довольно легко. Антитела и клеточно-опосредованный иммунитет, выработанные либо активной, либо пассивной иммунизацией, потенциально способны специфически элиминировать в предстательной железе злокачественные клетки [21]. Хотя при раковой опухоли, не выходящей за пределы простаты, в большинстве случаев эффективна радикальная простатэктомия, лечение метастатического и андроген-независимого рака предстательной железы пока не приводит к желаемым результатам [16]. Laser ablation of the prostate in patients with benign prostatic hypertrophy. VISUAL LASER ABLATION OF THE PROSTATE (VLAP) WITH BARE FIBER IN CONJUNCTION WITH LASER BLADDER NECK INCISION IN THE TREATMENT OF PATIENTS WITH BENIGN PROSTATIC HYPERPLASIA (BPH). является мишенью при иммунотерапии рака простаты, т. степень его экспрессии очень высока и регулируется уровнем андрогенов [17, 29]. Costello AJ, Bowsher WG, Bolton DM, Braslis KG, Burt J. Вакцина PSA вызывает образование антител к множеству поверхностных этитопов или детерминант антигенов клеток рака простаты [21, 29]. The latest research on immune therapy for prostate cancer. Это позволяет предположить, что иммунотерапия при прогрессирующих опухолях окажется достаточно эффективной [20]. Многие опухольассоциированные антигены слабо иммуногенны, и к ним часто возникает иммунологическая толерантность. Результаты некоторых исследований продемонстрировали, что ксеноантигенная иммунизация у человека может нарушить толерантность к собственным антигенам, приводя к клинически выраженному противоопухолевому эффекту [18]. Каким образом вакцина РЕСАН может помочь при этих заболеваниях? На mwnllhetdsavatarrprwlcagalvlaggffllgflfgwfikssneatn itpkhnmkafldelkaenikkflhnftqiphlagteqnfqlakqiqsqwke fgldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyen vsdivppfsafspqgmpegdlvyvnyartedffklerdmkincsgkiviar ygkvfrgnkvknaqlagakgvilysdpadyfapgvksypdgwnlpgggvqr gnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpigyydaqkll ekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtriyn vigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkke gwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegn ytlrvdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmp risklgsgndfevffqrlgiasgrarytknwetnkfsgyplyhsvyetyel vekfydpmfkyhltvaqvrggmvfelansivlpfdcrdyavvlrkyadkiy sismkhpqemktysvsfdslfsavknfteiaskfserlqdfdksnpivlrm mndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfd ieskvdpskawgevkrqiyvaaftvqaaaetlsevamwvpvvfltlsvtwigaaplilsrivggwecekhsqpwqvlvasrgravcggv lvhpqwvltaahcirnksvillgrhslfhpedtgqvfqvshsfphplydmsll knrflrpgddsshdlmllrlsepaeltdavkvmdlptqepalgttcyasgwgs iepeefltpkklqcvdlhvisndvcaqvhpqkvtkfmlcagrwtggkstcsgd sggplvcngvlqgitswgsepcalperpslytkvvhyrkwikdtivanp Благодаря подобранной комбинации имитаторов эпитопов опухолевых антигенов вакцина РЕСАН способна индуцировать выраженный ответ против опухоли простаты. Tablets Patient Information about PROSCAR ® (Prahs-car). Более того, гликопротеиновые структуры, входящие в состав вакцины, играют важную роль в усилении этого иммунного ответа. University of Texas Southwestern Medical Center 25-Feb-98. Противораковые вакцины именно этого типа ученые всего мира разрабатывают в течение последнего десятилетия. Effectiveness of Proscar in Treating Enlarged Prostates. Вакцина эффективна при лечении ДГПЖ и рака простаты. При ее рациональном использовании результаты весьма многообещающи. У пациентов с ДГПЖ или аденомой простаты иммунотерапию можно проводить без сочетания с какими-либо другими лекарственными препаратами. В течение 4 – 6 недель после вакцинации наблюдается регрессия размеров простаты, нормализация уровня PSA и выраженное клиническое улучшение состояния пациента. В случае рака простаты наилучшие результаты наблюдаются при комбинации введения вакцины с хирургическим лечением – задерживается развитие или происходит регрессирование метастазов, разрушаются микрометастазы, предотвращается рецидивирование, что приводит к долговременной ремиссии. Kankakee Urological Associates, LTD * Riverside Medical Center. Об эффективности лечения свидетельствуют снижение уровня опухолевого маркера, изменение уровня цитокинов и уменьшение размеров опухоли по данным КТ и УЗИ. Препарат РЕСАН может быть рекомендован в качестве альтернативного метода лечения рака простаты, если операция невозможна или сопровождается слишком большим риском, т. это неинвазивный, не токсичный и не деструктивный метод, основанный на активации собственной системы иммунитета пациента. Prostatic intraepithelial neoplasia is a risk factor for adenocarcinoma. Как указано выше, рак предстательной железы может развиваться на фоне ДГПЖ (аденомы простаты) и внутриэпителиальной неоплазии простаты. Более того, аденома простаты может маскировать проявления начального периода рака простаты. В этих случаях уровень PSA может находиться в пределах от 4 до 10 нг/мл. Если уровень PSA более 10 нг/мл, диагноз рака простаты не вызывает больших сомнений. Если же уровень PSA от 4 до 10 нг/мл, сложно решить, имеем мы дело с аденомой или же это начальная стадия рака простаты (или рецидив заболевания после радикального лечения). Вакцина РЕСАН не имеет существенных побочных эффектов и безопасна для применения при всех стадиях опухолей. Allogeneic whole-cell vaccine: a phase I/II study in men with hormone-refractory prostate cancer. С другой стороны, как раз при значениях PSA от 4 до 10 нг/мл использование вакцины для лечения или предотвращения развития рака наиболее эффективно, приводя к полной нормализации уровня PSA у 90% пациентов в течение 1-2 месяцев после введения вакцины. Она может быть рекомендована даже пациентам с поздними стадиями опухолей, при неэффективности традиционных методов лечения и при рецидивировании опухоли после традиционных методов лечения (См. Eaton JD, Perry MJ, Nicholson S, Guckian M, Russell N, Whelan M, Kirby RS. новый подход к лечению поздних стадий злокачественных опухолей). Natural anti-Gal antibody as a universal augmenter of autologous tumor vaccine immunogenicity. Winship Cancer Institute, Department of Hematology and Oncology, Emory University School of Medicine, 1365 Clifton Road, Suite B4100, Atlanta, Georgia 30322, USA. PATE, a gene expressed in prostate cancer, normal prostate, and testis, identified by a functional genomic approach. Division of Oncology, St George's Hospital Medical School, London, UK. Evidence of determinant spreading in the antibody responses to prostate cell surface antigens in patients immunized with prostate-specific antigen. Beth Israel Deaconess Medical Center, 21-27 Burlington Avenue, Room 556, Boston, MA 02215, USA. Применение вакцины РЕСАН эффективно также у пациентов из группы динамического наблюдения по поводу ДГПЖ и аденомы простаты. Bera TK, Maitra R, Iavarone C, Salvatore G, Kumar V, Vincent JJ, Sathyanarayana BK, Duray P, Lee BK, Pastan I. A unique folate hydrolase, prostate-specific membrane antigen (PSMA): a target for immunotherapy? Department of Urology, Memorial Hospital, Memorial Sloan-Kettering Cancer Center, New York, NY 10021, USA. Dendritic cell-based xenoantigen vaccination for prostate cancer immunotherapy. Для них именно введение вакцины является первоочередным выбором лечения с реальными шансами на полное выздоровление (в зависимости от стадии заболевания) и предупреждение злокачественного перерождения. Laboratory of Molecular Biology and Laboratory of Pathology, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892, USA. Heterogeneous expression of MAGE-A genes in occult disseminated tumor cells: a novel multimarker reverse transcription-polymerase chain reaction for diagnosis of micrometastatic disease. University of California at San Francisco Comprehensive Cancer Center, 1600 Divisidero Street, 3rd floor, San Francisco, CA 94115, USA. Proscar Pronounced: PRAHS-car, Generic name: Finasteride. Fong L, Brockstedt D, Benike C, Breen JK, Strang G, Ruegg CL, Engleman EG. Нa Эффективность применения вакцины РЕСАН при ДГПЖ и аденоме простаты При гистологическом исследовании аденомы обнаруживают железистые образования, выстланные цилиндрическим эпителием, кистозные полости, волокна соединительной и мышечной ткани. Kufer P, Zippelius A, Lutterbuse R, Mecklenburg I, Enzmann T, Montag A, Weckermann D, Passlick B, Prang N, Reichardt P, Dugas M, Kollermann MW, Pantel K, Riethmuller G. Kennedy-Smith AG, Mc Kenzie JL, Owen MC, Davidson PJ, Vuckovic S, Hart DN. Department of Pathology, Stanford University School of Medicine, Palo Alto, CA 94304, USA. В зависимости от преобладания той или иной ткани различают 4 формы ДГПЖ, от чего и зависит эффективность иммунотерапии препаратом РЕСАН. При преобладании железистой ткани (аденома) иммунотерапия эффективна примерно в 80-85% случаев. Institute of Immunology, University of Munich, 80336 Munich, Germany. Analysis of endogenous peptides bound by soluble MHC class I molecules: a novel approach for identifying tumor-specific antigens. Urology Department and Haematology Research Group, Christchurch Hospital and Molecular Pathology, Canterbury Health Laboratories, Christchurch, New Zealand. Prostate stem cell antigen: Identification of immunogenic peptides and assessment of reactive CD8 T cells in prostate cancer patients. Kiessling A, Schmitz M, Stevanovic S, Weigle B, Holig K, Fussel M, Fussel S, Meye A, Wirth MP, Rieber EP. Department of Urology, University of California - Los Angeles School of Medicine, Los Angeles, California, USA. В этих случаях, как минимум, происходит остановка роста аденомы или ее частичная регрессия и восстановление оттока мочи, нормализация функций мочевыделительной системы, как максимум – полное исчезновение аденомы.2. Digital Rectal Examination and Prostate Specific Antigen. Barnea E, Beer I, Patoka R, Ziv T, Kessler O, Tzehoval E, Eisenbach L, Zavazava N, Admon A. Institute of Immunology, Medical Faculty, Technical University of Dresden, Dresden, Germany. Role of prostate stem cell antigen in prostate cancer research. При преобладании фиброзной ткани (фиброаденома) иммунотерапия эффективна примерно в 80-85% случаев.3. The Smoler Protein Center, Department of Biology, Technion, Haifa, Israel. Gene therapy of prostate cancer: current and future directions. Winship Cancer Institute, Department of Hematology and Oncology, Emory University School of Medicine, 1365 Clifton Road, Suite B4100, Atlanta, Georgia 30322, USA. При преобладании мышечной ткани (аденомиома) иммунотерапия эффективна примерно в 50-60% случаев.4. При смешанных формах неоплазии иммунотерапия эффективна примерно в 60-85% случаев. Наиболее часто развиваются две первые гистологические формы. Препараты, применяемые совместно с вакциной РЕСАНАспирин. С 7 дня после введения вакцины по 0,125 мг утром и вечером. Проскар является синтетическим ингибитором 5-a-редуктазы. Считается одним из наиболее эффективных существующих препаратов для лечения аденомы предстательной железы, должен применяться по 5 мг 1 раз в сутки не менее 6 месяцев. Омник – ингибитор a-1-адренорецепторов, расположенных в шейкемочевого пузыря – имеет смысл применять только для ликвидации выраженных дизурических явлений (дозировка – 0,4 мг 1 раз в сутки). Применение вакцины РЕСАН совместно с общепринятой системой ведения больных с заболеваниями предстательной железы может сыграть уникальную роль в профилактике и лечении доброкачественной и злокачественной патологии простаты. Family Practice Notebook, Radical Prostatectomy by Scott Moses, MD, last revised 9/29/2002. Treatment of Prostate Cancer: Radioactive Seed Implantation , (Brachytherapy). Department of Radiology, Crittenton Hospital, Rochester, MI (248) 652-5611. Hormone Therapy Plus Chemotherapy in Treating Patients With Prostate Cancer. PROSTATE CANCER Treatment: Advanced Systemic Disease. Chemotherapy Combination Promising for Advanced Prostate Cancer. Taxotere®/Estramustine/Prednisone: New Standard of Care for Hormone-Refractory Prostate Cancer? David Crawford, Aubrey Pilgrim, Stephen Strum, Israel Barken, Bob Leibowitz and Contributions from Several Survivors. Brachytherapy for Prostate Cancer - Recovery Complications, Medicines and Heart Concerns. Cryotherapy (Freezing) Treatment for Localized Prostate Cancer. Prostate Center and Department of Urology (434) 924-2224. The Newest Alternative for Treating Early Prostate Cancer. Copyright 1999 - 2017 Resan Scientific Research Enterprise Материалы сайта защищены авторским правом. Department of Radiology, Crittenton Hospital, Rochester, MI (248) 652-5611.

Next

Аденома простаты злокачественная опухоль лечение

Аденома простаты. врач может назначить лечение. злокачественная опухоль в тканях. Аденома чаще всего встречается у мужчин после достижения 50 лет и не является метастазирующей опухолью, чем и отличается от рака простаты. Рак простаты – злокачественная опухоль, возникающая из эпителия альвеолярно-клеточных желез. Симптомы вышеперечисленных заболеваний сложно отличить друг от друга: боль в промежности, частое мочеиспускание, увеличение его времени, задержка мочи. После полного диагностирования заболевания и определения его типа, специалисты составляют индивидуальную программу лечения. При обнаружении аденомы простаты врачи Израиля применяют такие методы лечения, как: Далее наступает этап реабилитации пациента, необходимы регулярные обследования: в первый год после прохождения лечения каждые три месяца, следующие четыре года – каждые шесть месяцев, затем – один раз в год.

Next

Аденома простаты злокачественная опухоль лечение

Рак простаты – что это и какая существует классификация. Причины и симптомы разных стадий. Нарушение мочеиспускания, болевой синдром, снижение эректильной функции, запоры – все эти симптомы наблюдаются при злокачественном и доброкачественном образовании простаты. Аденома и рак предстательной железы, по крайней мере на начальных стадиях имеют схожую клиническую картину. Для дифференцирования патологии требуется использование инструментальных методов диагностики. Главное отличие рака простаты от аденомы простаты – этиология и характер ДГПЖ. Доброкачественное образование разрастается долгий период времени, не выходит за границы капсулы железы и не дает метастаз. От первичных признаков до полного развития проходит от 2-4 лет. Клетки активно развиваются, распространяются на ближайшие и отдаленные внутренние органы. При отсутствии должного лечения, пациент умирает в течение 5 лет. Существует распространенное мнение, что аденома простаты может перейти в рак простаты. Аденома и злокачественная опухоль – это два разных заболевания, имеющих различную локализацию. В чем скрывается причина, что даже в именитых медицинских изданиях указывается, что произошло перерождение аденомы предстательной железы в рак? Доброкачественная опухоль приводит к серьезным сбоям в работе простаты. Угнетается иммунная система, нарушаются обменные процессы, появляются застойные явления, создается благотворная среда для формирования онкологии. Дальнейшее развитие доброкачественной опухоли и ее лечение только усугубляет ситуацию. Тезис, что аденома переродилась в рак неточный, на самом деле речь идет о том, что опухоль спровоцировала и создала предпосылки к ускоренному росту онкологии. Онкозаболевание маскируется под аденому, имеет общую симптоматику. Даже с использованием современных методов диагностики, приблизительно в 15% случаев рак остается не выявленным. Достаточно часто встречаются ситуации, когда после операции по удалению аденомы простаты обнаружили раковые клетки. Определить онкологическое заболевание на начальной стадии, особенно если оно маскируется на фоне гиперплазии предстательной железы, достаточно проблематично. Первое, что дает причины заподозрить злокачественную опухоль – увеличившийся объем ПСА. Простат-специфический антиген – это своеобразный онкомаркер. Постоянное увеличение объема ПСА в крови – указывает на развитие онкозаболевания. После получения результатов на ПСА, пациенту требуется пройти дифференциальную диагностику с обязательным применением инструментальных методов исследования: На ранних стадиях заболевания УЗИ различия отсутствуют. Требуется применение более точных методов исследования. Хорошие результаты показала магнитно-резонансная томография и ПЭТ. Последний способ выявляет нарушения в функциональности тканей и по своей информативности в некоторых случаях даже опережает МРТ. При подозрении на онкозаболевание пациенту следует тесно сотрудничать с лечащим врачом, с целью подтвердить или опровергнуть диагноз и назначить своевременное лечение.

Next

Аденома простаты злокачественная опухоль лечение

Важно понимать, что аденома и рак простаты – это разных заболевания. Первая представляет собой доброкачественную опухоль, которая развиваетсяТакже в современной медицине для лечения злокачественного новообразования применяется аппарат Да Винчи. Простатит и аденома простаты, хоть и являются заболеваниями предстательной железы, но считаются совершенно разными понятиями, и единственное что их действительно объединяет, так это, то, что среди мужского населения, признаки хронического простатита и аденомы, самые распространенные среди всех других типов заболеваний. Аденома может возникнуть вследствие простатита, то есть при не оказанном лечении, либо же на фоне простатита хронического типа. Простатит и аденома предстательной железы, относятся к категории особо опасных мужских заболеваний и способны довести до полной импотенции и даже до рака простаты, излечить который можно лишь на первой и второй стадии. Остальные стадии, практически всегда доводят мужчину до летального исхода и чтобы предупредить развитие этих заболеваний, необходимо знать, что именно представляют из себя аденома простаты и простатит. При остром течении заболевания, она всегда выделяется выраженными симптомами, а симптомы хронического простатита практически не возникают, но изредка возникают обострения с весьма неприятной симптоматикой. Разница между простатитом и аденомой простаты состоит в том, что воспаление простаты является первым шагом на пути к возникновению доброкачественной опухоли. Воспаление простаты и простатит, это одни понятия одного и того же заболевания, и проявляется оно: Главная профилактика простатита и аденомы простаты, это полноценный и здоровый образ жизни, занятия спортом, правильное питание и регулярное обследование предстательной железы, минимум раз в 6 месяцев. Основное отличие простатита от аденомы простаты заключается в том, что аденома и является следствием простатита. Если у взрослого мужчины начинает пропадать утренняя эрекция, этот знак следует принять во внимание и не стоит относиться к таким вопросам скептически, поскольку сами, проблемы такого уровня не пропадают и разобраться в этом сможет только врач. Что касается самолечения, то оно не просто бессмысленно в данной ситуации, но и глупо и недопустимо. Что касается средств народной медицины, к которым некоторые мужчины свойственны, обращаться, то хотя эти методики и имеют место при хроническом простатите и аденоме простаты, но применять их следует лишь в составе комплекса, который включает медикаментозное лечение простатита. Когда у пациента встает вопрос, простатит или аденома, и в чем их характерные отличия, отметить следует то, что под простатитом понимается воспаление, а аденома простаты – уже имеющаяся доброкачественная опухоль предстательной железы. Симптомы аденомы простаты хоть и являются практически идентичными с простатитом, но лечить эти два заболевания следует по совершенно разным схемам. Простатит и аденома различаются еще и тем, что последняя характерна для мужчин от 45 лет и старше и от воспаления отличается тем, что год от года простатит молодеет, и его развитие у мужчин способно возникнуть даже в 30 лет. Когда аденома развивается, у мужчины разрастается ткань в предстательной железе, и при этом в ней появляются небольшие узлы в виде доброкачественной опухоли. Возникнуть аденома предстательной железы способна по некоторым причинам: Если не приступить к лечению своевременно, то это может привести к тому, что на первый взгляд вполне безобидные и доброкачественные узлы перейдут в стадию злокачественных, и в этом случае процедура лечения станет более сложной. На сегодняшний день, если мужчина обратится к врачу при возникновении первых признаков, простатит можно вылечить в 100 случаях из 100, то есть шанса в дальнейшем развитии у заболевания не останется. Поскольку уровень хронического воспаления простаты характеризуется в возникновении острых периодов, в этом случае, при обращении к урологу, в первую очередь будет назначена диагностика простатита, после которой в виде лечения назначаются препараты для того чтобы избавить мужчину от неприятных симптомов. Для того чтобы такое заболевание как простатит не возвратилось, следует: Поскольку человеческое тело ежеминутно вырабатывает миллионы раковых клеток, которые одолеть и коагулировать сможет лишь сильный иммунитет, а курение, алкоголь и халатное отношение к своему здоровью, лечению простатита и аденомы, заметно снижает его, риск злокачественных опухолей вырастает на 56%. Что такое аденома, уже говорилось выше и ее лечение может сильно отличаться от терапии простатита, например при аденоме, запрещаются некоторые физиопроцедуры, которые наоборот показаны при простатите. Основные методы лечения, направляются на то чтобы снизить опухоли и иногда, врачами приветствуются оперативные вмешательства. Сегодняшняя медицина шагает широким шагом и у врачей имеется возможность успешно проводить операции с помощью малоинвазивной и высокотехнологической аппаратуры, и это значит, что все манипуляции проводятся без разрезов, через обычные проколы в коже. Начинаются проблемы с эрекцией, а опухоль может стать раковой! Достаточно пройти курс этим средством…Читать далее.. »Масштабные клинические исследования урологических пластырей «ZB PROSTATIC NAVEL PLASTER» были проведены в Амстердамском медицинском университете (Нидерланды) в 2013 году. Всего в исследованиях принимало участие более 1000 мужчин с различными заболеваниями мочеполовой системы. Все испытуемые использовали китайские урологические пластыри«ZB PROSTATIC NAVEL PLASTER» на протяжении 3 недель.

Next

Рак аденомы простаты симптомы, лечение, диагностика

Аденома простаты злокачественная опухоль лечение

Аденома это доброкачественная опухоль, представляющая собой разросшуюся предстательную железу. Рак простаты развившаяся в ней злокачественная опухоль. Диагноза «рак аденомы простаты» как такового не существует, поскольку рак простаты и аденома простаты – это разные заболевания, никак не связанные между собой. Однако многие мужчины, которым диагностирована аденома предстательной железы, переживают, не может ли аденома простаты перерасти в рак при каких-либо условиях. Рассмотрим, в чем состоят основные отличия заболеваний и какое лечение необходимо при каждом из них. Увеличение предстательной железы возможно при простатите, при аденоме простаты и при раке простаты. Простатит возникает вследствие инфекции и представляет собой воспалительный процесс. Аденома – это доброкачественная опухоль, которая не вызывается инфекцией. Рак простаты – это недуг, характерным отличием которого является формирование злокачественной опухоли предстательной железы. Другое отличие доброкачественного образования от злокачественного в том, что раковые клетки могут относительно быстро распространяться по организму (с помощью крови, лимфы, соседних систем организма), поражая другие органы. Медицина не находит подтверждения тому, что аденома и рак взаимосвязаны, поэтому страхи мужчин о том, что аденома может переходить в рак, напрасны. Отличием заболеваний также является то, что рак простаты растет наружу, а аденома – вовнутрь. Определить отличия рака и аденомы простаты может только врач-уролог или онколог на основе лабораторных и инструментальных тестов и тщательного обследований пациента. Таблица отличий аденомы простаты и аденокарциномы (рака предстательной железы): Злокачественная опухоль, метастазы которой могут разрастаться на другие органы (прямая кишка, мочевой пузырь, мышцы). На сложных стадиях рака атипичные клетки могут переноситься при помощи крови и лимфы. Есть ли отличие в симптомах рака и аденомы предстательной железы и как проявляются эти недуги? Обычно первыми симптомами становятся сложности с мочеиспусканием (боль, сильное жжение, постоянное чувство наполненности мочевого пузыря и частые позывы) и половые дисфункции. Данные симптомы не всегда свидетельствуют об опухоли железы, следовательно в первую очередь необходимо обратиться к специалисту и пройти полное обследование. Аденома железы на разных стадиях может проявляться такими же симптомами, как и рак, поэтому не следует впадать в панику при начальных признаках. Какие симптомы должны насторожить пациента и заставить его пойти к врачу незамедлительно для исключения рака предстательной железы? Следует заметить, что рак на первых стадиях может не давать о себе знать. При злокачественном поражении предстательной железы симптомы рака могут проявляться постепенно, и каждый из них в отдельности может быть признаком какой-либо другой проблемы мочеполовой системы мужчины. В любом случае такие симптомы – это повод как можно быстрее обратиться к врачу, пройти обследование и начать лечение. При подозрительных симптомах врач-уролог назначает такие диагностические мероприятия, как определение ПСА в крови (раковый маркер железы), УЗИ и МРТ простаты, пальпация железы. При повышении уровня простатического антигена в крови и подтвержденной по УЗИ опухоли показана биопсия железы, которая позволит выяснить ее характер (злокачественная или доброкачественная). При помощи биопсии можно также определить структуру и даже стадию развития рака. Существует промежуточная стадия рака – атипическая гиперплазия железы. При обнаружении аденомы или рака простаты на ранней стадии в большинстве случаев прогноз благоприятный. Для рака простаты лечение требует комплексного подхода и включает в себя такие серьезные методы, как хирургическая операция, химиотерапия и другие, в зависимости от стадии. После того как вы прошли обследование и врач поставил окончательный диагноз (рак или аденома), следует начинать лечение. Как правильно лечить аденому предстательной железы? Основная задача – это не только мониторинг, но и коррекция образа жизни, питания, отказ от вредных привычек, прохождение регулярного обследования. Такой способ применяется при начальных стадиях и во время приема назначенных медикаментов, когда подобные мероприятия позволяют нормализовать состояние железы. Лечение включает в себя как прием медицинских препаратов, так и дополнительное (поддерживающее) лечение народными способами. Препараты могут замедлить рост аденомы и даже остановить процесс ее разрастания. В качестве лечения применяются ингибиторы 5-альфа редуктазы (влияют на уменьшение разросшихся тканей) и альфа-адреноблокаторы (влияют на расслабление мышц, тем самым облегчая мочеиспускание). Кроме того, в терапии аденомы железы применяют антибиотики, спазмолитики, антисептики и противовоспалительные таблетки и свечи. К малоинвазивным способам лечения аденомы простаты относятся лазерное лечение, криотерапия, лечение ультразвуком. Это современные методы, которые позволяют избежать серьезного хирургического вмешательства. Хирургическое лечение необходимо в том случае, когда: При своевременном обращении к врачу прогноз рака простаты благоприятный, особенно если недуг выявили на первых стадиях. Окончательный результат зависит не только от грамотности и профессионализма врача, но и от возраста и состояния здоровья пациента. Для этого необходимо своевременно обратиться к урологу.

Next